| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SSR2 |
|---|
| Clone | 4C1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SSR2 Antibody (4C1) from Novus Biologicals is a mouse monoclonal antibody to SSR2. This antibody reacts with human. The SSR2 Antibody (4C1) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | SSR2 (NP_003136.1, 51 a.a. - 150 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDW |
|---|
| Other Names | DKFZp686F19123, Signal sequence receptor subunit beta, signal sequence receptor, beta (translocon-associated protein beta), SSR-beta, TLAP, translocon-associated protein beta, translocon-associated protein subunit beta, TRAP-beta, TRAPBTRAP-BETA |
|---|
| Gene, Accession # | SSR2, Gene ID: 6746, Accession: NP_003136, SwissProt: NP_003136 |
|---|
| Catalog # | H00006746-M01 |
|---|
| Price | |
|---|
| Order / More Info | SSR2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|