| 产品详情 |
| Edit |   |
| Antigenic Specificity | SSR3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 24218363). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SSR3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SSR3. This antibody reacts with human, mouse, rat. The SSR3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat SSR3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEA |
| Other Names | signal sequence receptor, gamma (translocon-associated protein gamma), SSR gamma, SSR-gamma, translocon-associated protein gamma subunit, translocon-associated protein subunit gamma, TRAP-complex gamma subunit, TRAP-gamma, TRAPGSignal sequence receptor subunit gamma |
| Gene, Accession # | SSR3, Gene ID: 6747 |
| Catalog # | NBP1-80667 |
| Price | |
| Order / More Info | SSR3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 24218363 |
| 产品资料 |
|
|