| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ADTB1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ADTB1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADTB1. This antibody reacts with human, mouse, rat. The ADTB1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to AP1B1 (adaptor-related protein complex 1, beta 1 subunit) The peptide sequence was selected from the C terminal of AP1B1. Peptide sequence KLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKE. |
|---|
| Other Names | Adapter-Related Protein Complex 1 Subunit Beta-1, Adaptor Protein Complex AP-1 Subunit Beta-1, Adaptor-Related Protein Complex 1, Beta 1 Subunit, AP-1 Complex Subunit Beta-1, AP105A, AP1B1, BAM22, beta1-adaptin, Beta-1-adaptin, Beta-Adaptin 1, beta-prime-adaptin, CLAPB2, Clathrin Assembly Protein Complex 1 Beta Large Chain, Golgi Adaptor HA1/AP1 Adaptin Beta Subunit, Plasma Membrane Adaptor HA2/AP2 Adaptor Beta Subunit |
|---|
| Gene, Accession # | AP1B1, Gene ID: 162, Accession: Q10567, SwissProt: Q10567 |
|---|
| Catalog # | NBP1-68947-20ul |
|---|
| Price | |
|---|
| Order / More Info | ADTB1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|