| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ZNF214 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF214 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF214. This antibody reacts with human. The ZNF214 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ZNF214 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CGCNKCKGIYYWNSRCVFHKRNQPGENLCQCSIRKACFSQRSDLYRHPRNHIGKKLYGCDEVDGNFHQSSGVHFH |
|---|
| Other Names | BAZ 1, BAZ1, BAZ-1, BWSCR2-Associated Zinc Finger Protein 1, DKFZp564D0764, early hematopoietic zinc finger, Early hematopoietic zinc finger protein, EHZFLIP3, Evi3, LYST-interacting protein 3, MGC142182, MGC142208, zinc finger protein 521 |
|---|
| Gene, Accession # | ZNF214, Gene ID: 7761, Accession: Q9UL59, SwissProt: Q9UL59 |
|---|
| Catalog # | NBP2-31602 |
|---|
| Price | |
|---|
| Order / More Info | ZNF214 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|