| Edit |   |
| Antigenic Specificity | ZNF224 |
| Clone | 2C12 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF224 Antibody (2C12) from Novus Biologicals is a mouse monoclonal antibody to ZNF224. This antibody reacts with human. The ZNF224 Antibody (2C12) has been validated for the following applications: Western Blot, ELISA. |
| Immunogen | ZNF224 (NP_037530.1, 95 a.a. - 190 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HQEWSFQQIWEKIASDLTRSQDLVINSSQFSKEGDFPCQTEAGLSVIHTRQKSSQGNGYKPSFSDVSHFDFHQQLHSGEKSHTCDECGKNFCYISA |
| Other Names | MGC30006, zinc finger protein 511 |
| Gene, Accession # | ZNF224, Gene ID: 7767, Accession: NP_037530, SwissProt: NP_037530 |
| Catalog # | H00007767-M01 |
| Price | |
| Order / More Info | ZNF224 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |