| Edit |   |
| Antigenic Specificity | ZNF226 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF226 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF226. This antibody reacts with human. The ZNF226 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human ZNF226The immunogen for this antibody is ZNF226. Peptide sequence KSFGRSAHLQAHQKVHTGDKPYKCDECGKGFKWSLNLDMHQRVHTGEKPY. |
| Other Names | KIAA0972MGC33740, zinc finger protein 510 |
| Gene, Accession # | ZNF226, Gene ID: 7769, Accession: NP_001027544, SwissProt: NP_001027544 |
| Catalog # | NBP1-79365 |
| Price | |
| Order / More Info | ZNF226 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |