| Edit |   |
| Antigenic Specificity | ZNF23 |
| Clone | 2D3 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF23 Antibody (2D3) from Novus Biologicals is a mouse monoclonal antibody to ZNF23. This antibody reacts with human. The ZNF23 Antibody (2D3) has been validated for the following applications: Western Blot, ELISA. |
| Immunogen | ZNF23 (NP_666016.1, 41 a.a. - 139 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GLQGLQTDIQTDNDLTKEMYEGKENVSFELQRDFSQETDFSEASLLEKQQEVHSAGNIKKEKSNTIDGTVKDETSPVEECFFSQSSNSYQCHTITGEQP |
| Other Names | FLJ45745, MGC2555, NOLZ-1, zinc finger protein 503 |
| Gene, Accession # | ZNF23, Gene ID: 7571, Accession: NP_666016, SwissProt: NP_666016 |
| Catalog # | H00007571-M02 |
| Price | |
| Order / More Info | ZNF23 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |