| Edit |   |
|---|
| Antigenic Specificity | IL-18 BPa/IL18BP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IL-18 BPa/IL18BP Antibody from Novus Biologicals is a rabbit polyclonal antibody to IL-18 BPa/IL18BP. This antibody reacts with human. The IL-18 BPa/IL18BP Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human IL-18 BPa/IL18BP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG |
|---|
| Other Names | IL-18BP, IL18BPa, interleukin 18 binding protein, interleukin-18-binding protein, MC51L-53L-54L homolog gene product, tadekinig-alfa |
|---|
| Gene, Accession # | IL18BP, Gene ID: 10068, Accession: O95998, SwissProt: O95998 |
|---|
| Catalog # | NBP2-38481 |
|---|
| Price | |
|---|
| Order / More Info | IL-18 BPa/IL18BP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|