| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IL-22BP/IL22 RA2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 25880879). ICC/IF reported in the scientific literature (PMID: 25008863). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IL-22BP/IL22 RA2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IL-22BP/IL22 RA2. This antibody reacts with human, mouse. The IL-22BP/IL22 RA2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human IL-22BP/IL22 RA2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP |
|---|
| Other Names | class II cytokine receptor, CRF2-10, CRF2-S1IL22BP, Cytokine receptor class-II member 10, Cytokine receptor family 2 member 10, Cytokine receptor family type 2, soluble 1, IL-22 receptor subunit alpha-2, IL-22BPCRF2X, IL-22RA2, IL-22R-alpha-2, interleukin 22 receptor, alpha 2, interleukin 22-binding protein, interleukin-22 receptor subunit alpha-2, Interleukin-22-binding protein, MGC150509, MGC150510, zcytoR16 |
|---|
| Gene, Accession # | IL22RA2, Gene ID: 116379 |
|---|
| Catalog # | NBP1-85455 |
|---|
| Price | |
|---|
| Order / More Info | IL-22BP/IL22 RA2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25008863, 25880879 |
|---|
| 产品资料 |
|
|