| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IL-22BP/IL22 RA2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Goat |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | 1.0 mg/ml |
|---|
| Applications | ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IL-22BP/IL22 RA2 Antibody from Novus Biologicals is a goat polyclonal antibody to IL-22BP/IL22 RA2. This antibody reacts with human, mouse, rat. The IL-22BP/IL22 RA2 Antibody has been validated for the following applications: ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity: IL22 RA2 |
|---|
| Immunogen | Synthetic peptide RVQFQSRNFHNILQWQPGRALTGNSSVY-C corresponding to 33-60 residues of N-terminus of human IL-22R-alpha-2 protein with cysteine added for conjugation to a carrier protein. |
|---|
| Other Names | class II cytokine receptor, CRF2-10, CRF2-S1IL22BP, Cytokine receptor class-II member 10, Cytokine receptor family 2 member 10, Cytokine receptor family type 2, soluble 1, IL-22 receptor subunit alpha-2, IL-22BPCRF2X, IL-22RA2, IL-22R-alpha-2, interleukin 22 receptor, alpha 2, interleukin 22-binding protein, interleukin-22 receptor subunit alpha-2, Interleukin-22-binding protein, MGC150509, MGC150510, zcytoR16 |
|---|
| Gene, Accession # | IL22RA2, Gene ID: 116379, Accession: Q969J5, SwissProt: Q969J5 |
|---|
| Catalog # | NB100-742 |
|---|
| Price | |
|---|
| Order / More Info | IL-22BP/IL22 RA2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|