| Edit |   |
| Antigenic Specificity | ZNF577 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF577 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF577. This antibody reacts with human. The ZNF577 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ZNF577 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RETAINSLTVEKPSSRSHTSLYMSELIQEQKTVNTVPIEMPSSGTPPLLNKSERLVGRNVVIVEQPFPRNQAFVVNQEFEQRISLTNEVNVAPSV |
| Other Names | FLJ32291, MGC4400, zinc finger protein 577 |
| Gene, Accession # | ZNF577, Gene ID: 84765, Accession: Q9BSK1, SwissProt: Q9BSK1 |
| Catalog # | NBP2-31013 |
| Price | |
| Order / More Info | ZNF577 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |