| Edit |   |
|---|
| Antigenic Specificity | ZNF579 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF579 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF579. This antibody reacts with human. The ZNF579 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ZNF579 (zinc finger protein 579) The peptide sequence was selected from the C terminal of ZNF579. Peptide sequence LASYLRQHRRVHGPLSLLAPLPAAGKKDDKASGARNSAKGPEGGEGAECG. |
|---|
| Other Names | FLJ35453, zinc finger protein 579 |
|---|
| Gene, Accession # | ZNF579, Gene ID: 163033, Accession: Q8NAF0, SwissProt: Q8NAF0 |
|---|
| Catalog # | NBP1-68922 |
|---|
| Price | |
|---|
| Order / More Info | ZNF579 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|