| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Proteasome 20S beta 6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Proteasome 20S beta 6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Proteasome 20S beta 6. This antibody reacts with human, mouse. The Proteasome 20S beta 6 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PSMB6(proteasome (prosome, macropain) subunit, beta type, 6) The peptide sequence was selected from the N terminal of PSMB6. Peptide sequence TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA. |
|---|
| Other Names | DELTA, EC 3.4.25.1, LMPY, Macropain delta chain, Multicatalytic endopeptidase complex delta chain, proteasome (prosome, macropain) subunit, beta type, 6, proteasome catalytic subunit 1, Proteasome delta chain, proteasome subunit beta 6, proteasome subunit beta type-6, proteasome subunit delta, Proteasome subunit Y, PSY large multifunctional protease Y, YMGC5169 |
|---|
| Gene, Accession # | PSMB6, Gene ID: 5694, Accession: P28072, SwissProt: P28072 |
|---|
| Catalog # | NBP1-56575-20ul |
|---|
| Price | |
|---|
| Order / More Info | Proteasome 20S beta 6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|