| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | YRDC |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The YRDC Antibody from Novus Biologicals is a rabbit polyclonal antibody to YRDC. This antibody reacts with human. The YRDC Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human YRDC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ASSLNVEEFQDLWPQLSLVIDGGQIGDGQSPECRLGSTVVDLSVPGKFGIIRPGCALESTTAILQQKYGLLP |
|---|
| Other Names | dopamine receptor interacting protein 3, Dopamine receptor-interacting protein 3, DRIP3, FLJ23476, FLJ26165, hIRIP, IRIPyrdC domain containing (E.coli), ischemia/reperfusion inducible protein, Ischemia/reperfusion-inducible protein homolog, RP11-109P14.4, SUA5, yrdC domain containing (E. coli), yrdC domain-containing protein, mitochondrial |
|---|
| Gene, Accession # | YRDC, Gene ID: 79693 |
|---|
| Catalog # | NBP1-82072 |
|---|
| Price | |
|---|
| Order / More Info | YRDC Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|