| Edit |   |
| Antigenic Specificity | ZADH2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZADH2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZADH2. This antibody reacts with human. The ZADH2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ZADH2(zinc binding alcohol dehydrogenase domain containing 2) The peptide sequence was selected from the N terminal of ZADH2. Peptide sequence MLRLVPTGARAIVDMSYARHFLDFQGSAIPQAMQKLVVTRLSPNFREAVT. |
| Other Names | MGC45594, zinc binding alcohol dehydrogenase domain containing 2, zinc-binding alcohol dehydrogenase domain-containing protein 2 |
| Gene, Accession # | ZADH2, Gene ID: 284273, Accession: Q8N4Q0, SwissProt: Q8N4Q0 |
| Catalog # | NBP1-56952-20ul |
| Price | |
| Order / More Info | ZADH2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |