| 产品详情 |
| Edit |   |
| Antigenic Specificity | Galanin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, monkey |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Galanin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Galanin. This antibody reacts with human, monkey. The Galanin Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, monkey Galanin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS |
| Other Names | GAL1, galanin, galanin prepropeptide, GALNgalanin-related peptide, GLNNgalanin-message-associated peptide, GMAP, MGC40167 |
| Gene, Accession # | GAL, Gene ID: 51083, Accession: P22466, SwissProt: P22466 |
| Catalog # | NBP2-33582 |
| Price | |
| Order / More Info | Galanin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 29676776 |
| 产品资料 |
|
|