| Edit |   |
| Antigenic Specificity | Galactosylceramidase/GALC |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 50ul |
| Concentration | lyophilized |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Galactosylceramidase/GALC Antibody from Novus Biologicals is a rabbit polyclonal antibody to Galactosylceramidase/GALC. This antibody reacts with human. The Galactosylceramidase/GALC Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to GALC(galactosylceramidase) The peptide sequence was selected from the middle region of GALC. Peptide sequence LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL. |
| Other Names | EC 3.2.1.46, galactocerebrosidase, Galactocerebroside beta-galactosidase, Galactosylceramidase, galactosylceramidase (Krabbe disease), Galactosylceramide beta-galactosidase, galactosylceraminidase, GALCERase |
| Gene, Accession # | GALC, Gene ID: 2581, Accession: P54803, SwissProt: P54803 |
| Catalog # | NBP1-62280 |
| Price | |
| Order / More Info | Galactosylceramidase/GALC Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |