| 产品详情 |
| Edit |   |
| Antigenic Specificity | CXorf22 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CXorf22 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CXorf22. This antibody reacts with human. The CXorf22 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CXorf22 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: APPPKSPPVVIQCQSRKRAEEKVEIILNAGFFGFSLTPDLTEVLVIPKRNSHNFCEDPNEIPKIHEFEYEIQFESEAMKSKLESCVALY |
| Other Names | Calponin Homology Domain Containing 2, Calponin Homology Domain-Containing Protein 2, CHDC2, chromosome X open reading frame 22, Chromosome X Open Reading Frame 30, chromosome X open reading frame 59, Cilia And Flagella Associated Protein 47, Cilia- And Flagella-Associated Protein 47, CXorf30, CXorf59, MGC34831 |
| Gene, Accession # | CFAP47, Gene ID: 286464, Accession: Q6ZTR5, SwissProt: A6PW82 |
| Catalog # | NBP2-30729 |
| Price | |
| Order / More Info | CXorf22 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|