| Edit |   |
|---|
| Antigenic Specificity | CXorf66 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CXorf66 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CXorf66. This antibody reacts with human. The CXorf66 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CXorf66(chromosome X open reading frame 66) The peptide sequence was selected from the middle region of CXorf66. Peptide sequence PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE. |
|---|
| Other Names | chromosome X open reading frame 66, hypothetical protein LOC347487 |
|---|
| Gene, Accession # | CXORF66, Gene ID: 347487 |
|---|
| Catalog # | NBP1-70511-20ul |
|---|
| Price | |
|---|
| Order / More Info | CXorf66 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|