| Edit |   |
| Antigenic Specificity | CXorf66 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CXorf66 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CXorf66. This antibody reacts with human. The CXorf66 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CXorf66(chromosome X open reading frame 66) The peptide sequence was selected from the middle region of CXorf66. Peptide sequence PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE. |
| Other Names | chromosome X open reading frame 66, hypothetical protein LOC347487 |
| Gene, Accession # | CXORF66, Gene ID: 347487 |
| Catalog # | NBP1-70511 |
| Price | |
| Order / More Info | CXorf66 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |