| Edit |   |
| Antigenic Specificity | CYB561 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CYB561 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CYB561. This antibody reacts with human. The CYB561 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CYB561(cytochrome b-561) The peptide sequence was selected from the middle region of CYB561. Peptide sequence NVLGLLLACFGGAVLYILTRADWKRPSQAEEQALSMDFKTLTEGDSPGSQ. |
| Other Names | cytochrome b561, cytochrome b-561FRRS2, ferric-chelate reductase 2 |
| Gene, Accession # | CYB561, Gene ID: 1534, Accession: P49447, SwissProt: P49447 |
| Catalog # | NBP1-60119 |
| Price | |
| Order / More Info | CYB561 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |