| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CYBB/NOX2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 50ul |
|---|
| Concentration | lyophilized |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CYBB/NOX2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CYBB/NOX2. This antibody reacts with human. The CYBB/NOX2 Antibody has been validated for the following applications: Western Blot. Specificity: Protein Accession# :NP_000388, Nucleotide Accession#:NM_000397 |
|---|
| Immunogen | The immunogen for Anti-CYBB antibody is: synthetic peptide directed towards the C-terminal region of Human CYBB, Protein (#AA): GRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGV |
|---|
| Other Names | CGD, CGD91-phox, Cytochrome b(558) subunit beta, cytochrome b-245 heavy chain, cytochrome b-245, beta polypeptide, Cytochrome b558 subunit beta, EC 1.6.3, GP91-1, GP91PHOX, GP91-PHOX, Heme-binding membrane glycoprotein gp91phox, NADPH oxidase 2, Neutrophil cytochrome b 91 kDa polypeptide, NOX2chronic granulomatous disease, p22 phagocyte B-cytochrome, p91-PHOX, Superoxide-generating NADPH oxidase heavy chain subunit |
|---|
| Gene, Accession # | CYBB, Gene ID: 1536, Accession: P04839, SwissProt: P04839 |
|---|
| Catalog # | NBP2-30099 |
|---|
| Price | |
|---|
| Order / More Info | CYBB/NOX2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|