| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | POU4F3 |
|---|
| Clone | 5B8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, RNA Inhibition. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, RNAi Validation and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The POU4F3 Antibody (5B8) from Novus Biologicals is a mouse monoclonal antibody to POU4F3. This antibody reacts with human. The POU4F3 Antibody (5B8) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, RNA Inhibition. |
|---|
| Immunogen | POU4F3 (NP_002691, 100 a.a. - 190 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAF |
|---|
| Other Names | brain-3C, Brain-specific homeobox/POU domain protein 3C, BRN3.1, Brn-3C, BRN3Cbrn-3C, DFNA15, MGC138412, POU class 4 homeobox 3, POU domain class 4, transcription factor 3, POU domain, class 4, transcription factor 3 |
|---|
| Gene, Accession # | POU4F3, Gene ID: 5459, Accession: NP_002691, SwissProt: NP_002691 |
|---|
| Catalog # | H00005459-M01 |
|---|
| Price | |
|---|
| Order / More Info | POU4F3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|