| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | POU3F2/OCT7 |
|---|
| Clone | CL6232 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The POU3F2/OCT7 Antibody (CL6232) from Novus Biologicals is a mouse monoclonal antibody to POU3F2/OCT7. This antibody reacts with human, mouse, rat. The POU3F2/OCT7 Antibody (CL6232) has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat POU3F2/OCT7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHP |
|---|
| Other Names | Brain-2, Brain-specific homeobox/POU domain protein 2, brn-2, BRN2brain-2, Nervous system-specific octamer-binding transcription factor N-Oct-3, Oct-7, OCT7POU domain class 3, transcription factor 2, Octamer-binding protein 7, Octamer-binding transcription factor 7, OTF7, OTF-7, POU class 3 homeobox 2, POU domain, class 3, transcription factor 2, POUF3 |
|---|
| Gene, Accession # | POU3F2, Gene ID: 5454 |
|---|
| Catalog # | NBP2-61437 |
|---|
| Price | |
|---|
| Order / More Info | POU3F2/OCT7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|