| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ADAM20 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ADAM20 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADAM20. This antibody reacts with human. The ADAM20 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ADAM20 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DAFYHPLEVDVILTGIDIWTASNPLPTSGDLDNVLEDFSIWKNYNLNNRLQHDVAHLFIKDTQGMKLGVAYVKGICQ |
|---|
| Other Names | a disintegrin and metalloproteinase domain 20, ADAM 20, ADAM metallopeptidase domain 20, disintegrin and metalloproteinase domain-containing protein 20, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.58 |
|---|
| Gene, Accession # | ADAM20, Gene ID: 8748, Accession: O43506, SwissProt: O43506 |
|---|
| Catalog # | NBP2-38872 |
|---|
| Price | |
|---|
| Order / More Info | ADAM20 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|