| Edit |   |
|---|
| Antigenic Specificity | ADAM22 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ADAM22 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADAM22. This antibody reacts with mouse. The ADAM22 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to Adam22 (a disintegrin and metallopeptidase domain 22) The peptide sequence was selected from the N terminal of mouse Adam22 (NP_001007222). Peptide sequence AISENPLITLREFMKYRRDFIKEKADAVHLFSGSQFESSRSGAAYIGGIC. |
|---|
| Other Names | ADAM 22, ADAM metallopeptidase domain 22, metalloproteinase-disintegrin ADAM22-3, metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2, MGC149832 |
|---|
| Gene, Accession # | ADAM22, Gene ID: 53616, Accession: Q9R1V6 |
|---|
| Catalog # | NBP1-69015 |
|---|
| Price | |
|---|
| Order / More Info | ADAM22 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|