| 产品详情 |
| Edit |   |
| Antigenic Specificity | APOA1BP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The APOA1BP Antibody from Novus Biologicals is a rabbit polyclonal antibody to APOA1BP. This antibody reacts with human. The APOA1BP Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human APOA1BP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SQTIACRSGPTWWGPQRLNSGGRWDSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRS |
| Other Names | AIBPAI-BP, apolipoprotein A-I binding protein, apolipoprotein A-I-binding protein, MGC119143, MGC119144, MGC119145, YjeF N-terminal domain-containing protein 1, YjeF_N1, YJEFN1apoA-I binding protein |
| Gene, Accession # | APOA1BP, Gene ID: 128240, Accession: Q8NCW5, SwissProt: Q8NCW5 |
| Catalog # | NBP2-30943 |
| Price | |
| Order / More Info | APOA1BP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|