| Edit |   |
|---|
| Antigenic Specificity | JHDM1D |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The JHDM1D Antibody from Novus Biologicals is a rabbit polyclonal antibody to JHDM1D. This antibody reacts with human. The JHDM1D Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen this antibody was a synthetic peptide directed towards the C terminal region of human JHDM1D. Sequence: CGYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRV |
|---|
| Other Names | jmjC domain-containing histone demethylation protein 1D, jumonji C domain containing histone demethylase 1 homolog D (S. cerevisiae), KDM7A |
|---|
| Gene, Accession # | JHDM1D, Gene ID: 80853, Accession: Q6ZMT4, SwissProt: Q6ZMT4 |
|---|
| Catalog # | NBP1-79714 |
|---|
| Price | |
|---|
| Order / More Info | JHDM1D Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29662139 |
|---|