| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LARS |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LARS Antibody from Novus Biologicals is a rabbit polyclonal antibody to LARS. This antibody reacts with human. The LARS Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human LARS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KWDTERVFEVNASNLEKQTSKGKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRLKGKCCLFPFGLHCTGMPIKACADKLK |
|---|
| Other Names | cytoplasmic leucyl-tRNA synthetase, FLJ21788, hr025Cl, HSPC192, KIAA1352, LARS1, leucine translase, leucine tRNA ligase 1, cytoplasmic, leucine-tRNA ligase, leucine--tRNA ligase, leucyl-tRNA synthetase, leucyl-tRNA synthetase, cytoplasmic, LEURS, LEUS, LRS, PIG44 |
|---|
| Gene, Accession # | LARS, Gene ID: 51520, Accession: Q9P2J5, SwissProt: Q9P2J5 |
|---|
| Catalog # | NBP2-38478 |
|---|
| Price | |
|---|
| Order / More Info | LARS Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|