| 产品详情 |
| Edit |   |
| Antigenic Specificity | N-Cadherin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reactivity reported in (PMID: 30250579) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The N-Cadherin Antibody from Novus Biologicals is a rabbit polyclonal antibody to N-Cadherin. This antibody reacts with human, mouse. The N-Cadherin Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human N-Cadherin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDP |
| Other Names | cadherin 2, N-cadherin (neuronal), cadherin 2, type 1, N-cadherin (neuronal), cadherin-2, CD325, CD325 antigen, CDHNcalcium-dependent adhesion protein, neuronal, CDw325, N-cadherin, NCADN-cadherin 1, Neural cadherin, neural-cadherin |
| Gene, Accession # | CDH2, Gene ID: 1000, Accession: P19022, SwissProt: P19022 |
| Catalog # | NBP2-38856 |
| Price | |
| Order / More Info | N-Cadherin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 29805551, 30250579 |
| 产品资料 |
|
|