| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GAPDH-2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GAPDH-2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GAPDH-2. This antibody reacts with human. The GAPDH-2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human GAPDH-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVIS |
|---|
| Other Names | EC 1.2.1, EC 1.2.1.12, GAPD2HSD-35, GAPDH2, GAPDH-2glyceraldehyde-3-phosphate dehydrogenase, testis-specific, GAPDS, glyceraldehyde-3-phosphate dehydrogenase, spermatogenic, Spermatogenic cell-specific glyceraldehyde 3-phosphate dehydrogenase 2, Spermatogenic glyceraldehyde-3-phosphate dehydrogenase |
|---|
| Gene, Accession # | GAPDHS, Gene ID: 26330, Accession: O14556, SwissProt: O14556 |
|---|
| Catalog # | NBP2-31925 |
|---|
| Price | |
|---|
| Order / More Info | GAPDH-2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24598113 |
|---|
| 产品资料 |
|
|