| 产品详情 |
| Edit |   |
| Antigenic Specificity | TAF7 |
| Clone | 2C5 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, RNA Inhibition |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TAF7 Antibody (2C5) from Novus Biologicals is a mouse monoclonal antibody to TAF7. This antibody reacts with human. The TAF7 Antibody (2C5) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, RNA Inhibition. |
| Immunogen | TAF7 (AAH32737, 130 a.a. - 224 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFN |
| Other Names | TAF(II)55, TAF2FTBP-associated factor F, TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa, TAFII-55, TAFII55RNA polymerase II TBP-associated factor subunit F, TATA box binding protein (TBP)-associated factor, RNA polymerase II, F, 55kD, transcription factor IID subunit TAFII55, Transcription initiation factor TFIID 55 kDa subunit, transcription initiation factor TFIID subunit 7, transcription initiation factor TFIID, 55 kDa subunit |
| Gene, Accession # | TAF7, Gene ID: 6879, Accession: AAH32737, SwissProt: AAH32737 |
| Catalog # | H00006879-M01 |
| Price | |
| Order / More Info | TAF7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 21368148, 23326641, 24082143, 25006164 |
| 产品资料 |
|
|