| 产品详情 |
| Edit |   |
| Antigenic Specificity | TAF7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TAF7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TAF7. This antibody reacts with human. The TAF7 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | TAF7 (NP_005633.2, 1 a.a. - 349 a.a.) full-length human protein. MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK |
| Other Names | TAF(II)55, TAF2FTBP-associated factor F, TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa, TAFII-55, TAFII55RNA polymerase II TBP-associated factor subunit F, TATA box binding protein (TBP)-associated factor, RNA polymerase II, F, 55kD, transcription factor IID subunit TAFII55, Transcription initiation factor TFIID 55 kDa subunit, transcription initiation factor TFIID subunit 7, transcription initiation factor TFIID, 55 kDa subunit |
| Gene, Accession # | TAF7, Gene ID: 6879, Accession: NP_005633.2, SwissProt: NP_005633.2 |
| Catalog # | H00006879-D01P |
| Price | |
| Order / More Info | TAF7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|