| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Tafazzin/TAZ |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. IHC reported in the literature (PMID: 24858921). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Tafazzin/TAZ Antibody from Novus Biologicals is a rabbit polyclonal antibody to Tafazzin/TAZ. This antibody reacts with human. The Tafazzin/TAZ Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Tafazzin/TAZ antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: WHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQP |
|---|
| Other Names | BTHSEFE, cardiomyopathy, dilated 3A (X-linked), CMD3A, EFE2FLJ27390, G4.5endocardial fibroelastosis 2, LVNCX, Protein G4.5, tafazzin, Taz1, XAP-2 |
|---|
| Gene, Accession # | TAZ, Gene ID: 6901 |
|---|
| Catalog # | NBP1-88511 |
|---|
| Price | |
|---|
| Order / More Info | Tafazzin/TAZ Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24858921 |
|---|
| 产品资料 |
|
|