| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TAF1D |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TAF1D Antibody from Novus Biologicals is a rabbit polyclonal antibody to TAF1D. This antibody reacts with human. The TAF1D Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TAF1D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YQPTGRPRGRPEGRRNPIYSLIDKKKQFRSRGSGFPFLESENEKNAPWRKILTFEQAVARGFFNYIEKLKYEHHL |
|---|
| Other Names | JOSD3RNA polymerase I-specific TBP-associated factor 41 kDa, Josephin domain containing 3, MGC5306, RAFI41, TAF(I)41, TAFI41, TATA box binding protein (TBP)-associated factor, RNA polymerase I, D, 41kDa, TATA box-binding protein-associated factor 1D, TATA box-binding protein-associated factor RNA polymerase I subunit D, TBP-associated factor 1D, Transcription initiation factor SL1/TIF-IB subunit D |
|---|
| Gene, Accession # | TAF1D, Gene ID: 79101, Accession: Q9H5J8, SwissProt: Q9H5J8 |
|---|
| Catalog # | NBP2-31821 |
|---|
| Price | |
|---|
| Order / More Info | TAF1D Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|