| 产品详情 |
| Edit |   |
| Antigenic Specificity | NAC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NAC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NAC1. This antibody reacts with human. The NAC1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human NAC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RVVRKSWMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAEAL |
| Other Names | BEND8, BTB (POZ) domain containing 14B, BTB/POZ domain-containing protein 14B, BTBD14B, NAC1BEN domain containing 8, NAC-1FLJ37383, nucleus accumbens associated 1, BEN and BTB (POZ) domain containing, nucleus accumbens-associated protein 1, transcriptional repressor NAC1 |
| Gene, Accession # | NACC1, Gene ID: 112939 |
| Catalog # | NBP2-49361 |
| Price | |
| Order / More Info | NAC1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|