| Edit |   |
|---|
| Antigenic Specificity | GCS1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GCS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GCS1. This antibody reacts with human. The GCS1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human GCS1The immunogen for this antibody is GCS1. Peptide sequence GPYGWEFHDGLSFGRQHIQDGALRLTTEFVKRPGGQHGGDWSWRVTVEPQ. |
|---|
| Other Names | GCS1, glucosidase I, mannosyl-oligosaccharide glucosidase, processing A-glucosidase I |
|---|
| Gene, Accession # | MOGS, Gene ID: 7841, Accession: NP_006293, SwissProt: NP_006293 |
|---|
| Catalog # | NBP1-79194 |
|---|
| Price | |
|---|
| Order / More Info | GCS1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|