| Edit |   |
| Antigenic Specificity | N-Acetyl-D-Glucosamine Kinase/NAGK |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The N-Acetyl-D-Glucosamine Kinase/NAGK Antibody from Novus Biologicals is a rabbit polyclonal antibody to N-Acetyl-D-Glucosamine Kinase/NAGK. This antibody reacts with human. The N-Acetyl-D-Glucosamine Kinase/NAGK Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human N-Acetyl-D-Glucosamine Kinase/NAGK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSE |
| Other Names | EC 2.7.1.59, GNKGlcNAc kinase, N-acetyl-D-glucosamine kinase, N-acetylglucosamine kinaseHSA242910 |
| Gene, Accession # | NAGK, Gene ID: 55577, Accession: Q9UJ70, SwissProt: Q9UJ70 |
| Catalog # | NBP2-38240 |
| Price | |
| Order / More Info | N-Acetyl-D-Glucosamine Kinase/NAGK Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |