| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | N-Acetylgalactosamine-6-Sulfatase/GALNS |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody from Novus Biologicals is a rabbit polyclonal antibody to N-Acetylgalactosamine-6-Sulfatase/GALNS. This antibody reacts with human. The N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TTHNLEDHTKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCNWAVMNWAPPGCEKLGKCLTPPESIPKK |
|---|
| Other Names | chondroitinase, chondroitinsulfatase, EC 3.1.6, EC 3.1.6.4, FLJ17434, FLJ42844, FLJ98217, galactosamine (N-acetyl)-6-sulfate sulfatase, Galactose-6-sulfate sulfatase, GALNAC6S, GalNAc6S sulfatase, GAS, MPS4A, N-acetylgalactosamine-6-sulfatase, N-acetylgalactosamine-6-sulfate sulfatase |
|---|
| Gene, Accession # | GALNS, Gene ID: 2588 |
|---|
| Catalog # | NBP2-62607 |
|---|
| Price | |
|---|
| Order / More Info | N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|