| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | N-Acetylglucosaminyltransferase III/MGAT3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The N-Acetylglucosaminyltransferase III/MGAT3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to N-Acetylglucosaminyltransferase III/MGAT3. This antibody reacts with human. The N-Acetylglucosaminyltransferase III/MGAT3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human N-Acetylglucosaminyltransferase III/MGAT3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RRKWVECVCLPGWHGPSCGVPTVVQYSNLPTKERLVPREVPRRVINAINVNHEFDLLDVRFHELGDVVDAFVVCESNFTAYG |
|---|
| Other Names | beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase, EC 2.4.1.144, FLJ43371, GGNT3, GlcNAc-T III, GNT3, GNT-IIIMGC142278, mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, MGC141943, N-acetylglucosaminyltransferase III, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III |
|---|
| Gene, Accession # | MGAT3, Gene ID: 4248 |
|---|
| Catalog # | NBP1-81810 |
|---|
| Price | |
|---|
| Order / More Info | N-Acetylglucosaminyltransferase III/MGAT3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|