| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DSS1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DSS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DSS1. This antibody reacts with human. The DSS1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human DSS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDED |
|---|
| Other Names | 26S proteasome complex subunit DSS1, Deleted in split hand/split foot protein 1, deleted in split-hand/split-foot 1, DSS1Split hand/foot malformation type 1 protein, ECD, SEM1, Shfdg1, SHSF1SHFD1, Split hand/foot deleted protein 1, split hand/foot malformation (ectrodactyly) type 1 |
|---|
| Gene, Accession # | SHFM1, Gene ID: 7979 |
|---|
| Catalog # | NBP2-57559 |
|---|
| Price | |
|---|
| Order / More Info | DSS1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|