| Edit |   |
| Antigenic Specificity | DTD2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DTD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DTD2. This antibody reacts with human. The DTD2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human C14orf126The immunogen for this antibody is C14orf126. Peptide sequence ETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYS. |
| Other Names | C14orf126, chromosome 14 open reading frame 126, EC 3.1, MGC9912, probable D-tyrosyl-tRNA(Tyr) deacylase 2 |
| Gene, Accession # | DTD2, Gene ID: 112487, Accession: NP_542395, SwissProt: NP_542395 |
| Catalog # | NBP1-79499-20ul |
| Price | |
| Order / More Info | DTD2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |