| Edit |   |
| Antigenic Specificity | Nesprin-4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Nesprin-4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Nesprin-4. This antibody reacts with human. The Nesprin-4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to Nesprin-4 The peptide sequence was selected from the N terminal of Nesprin-4. Peptide sequence GEESTSPEQAQTLGQDSLGPPEHFQGGPRGNEPAAHPPRWSTPSSYEDPA. |
| Other Names | chromosome 19 open reading frame 46, FLJ36445, nesprin-4 |
| Gene, Accession # | SYNE4, Gene ID: 163183, Accession: Q8N205, SwissProt: Q8N205 |
| Catalog # | NBP1-59767-20ul |
| Price | |
| Order / More Info | Nesprin-4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |