| Edit |   |
|---|
| Antigenic Specificity | TBCCD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TBCCD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TBCCD1. This antibody reacts with human. The TBCCD1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TBCCD1(TBCC domain containing 1). The peptide sequence was selected from the N terminal of TBCCD1. Peptide sequence WPSPRNKSQSPDLTEKSNCHNKNWNDYSHQAFVYDHLSDLLELLLDPKQL. |
|---|
| Other Names | FLJ10560, TBCC domain containing 1, TBCC domain-containing protein 1 |
|---|
| Gene, Accession # | TBCCD1, Gene ID: 55171, Accession: Q9NVR7, SwissProt: Q9NVR7 |
|---|
| Catalog # | NBP1-55394-20ul |
|---|
| Price | |
|---|
| Order / More Info | TBCCD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|