| Edit |   |
| Antigenic Specificity | GLT6D1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GLT6D1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GLT6D1. This antibody reacts with human. The GLT6D1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human GLT6D1The immunogen for this antibody is GLT6D1. Peptide sequence FGVETLGPLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLM. |
| Other Names | galactosyltransferase family 6 domain containing 1, galactosyltransferase family 6 domain-containing 1, glycosyltransferase 6 domain containing 1, glycosyltransferase 6 domain-containing protein 1, GT6M7 |
| Gene, Accession # | GLT6D1, Gene ID: 360203, Accession: NP_892019, SwissProt: NP_892019 |
| Catalog # | NBP1-79310-20ul |
| Price | |
| Order / More Info | GLT6D1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |