| Edit |   |
| Antigenic Specificity | GLTPD2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GLTPD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GLTPD2. This antibody reacts with human. The GLTPD2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human LOC388323. Peptide sequence GARSGCGPRAQPCVPGETAPFQVRQESGTLEAPERKQPPCLGPRGMLGRM. |
| Other Names | glycolipid transfer protein domain containing 2, glycolipid transfer protein domain-containing protein 2 |
| Gene, Accession # | GLTPD2, Gene ID: 388323, Accession: NP_001014985, SwissProt: NP_001014985 |
| Catalog # | NBP1-80542 |
| Price | |
| Order / More Info | GLTPD2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |