| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RHAG |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RHAG Antibody from Novus Biologicals is a rabbit polyclonal antibody to RHAG. This antibody reacts with human. The RHAG Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RHAG(Rh-associated glycoprotein) The peptide sequence was selected form the middle region of RHAG. Peptide sequence FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG. |
|---|
| Other Names | ammonium transporter Rh type A, CD241, CD241 antigen, Erythrocyte membrane glycoprotein Rh50, Erythrocyte plasma membrane 50 kDa glycoprotein, Rh family type A glycoprotein, Rh type A glycoprotein, RH50, Rh50A, RH50ARh50, Rh50GP, Rh-associated glycoprotein, Rhesus associated polypeptide, 50-KD, Rhesus blood group family type A glycoprotein, Rhesus blood group-associated ammonia channel, Rhesus blood group-associated glycoproteinRH2, SLC42A1 |
|---|
| Gene, Accession # | RHAG, Gene ID: 6005, Accession: Q02094, SwissProt: Q02094 |
|---|
| Catalog # | NBP1-62670 |
|---|
| Price | |
|---|
| Order / More Info | RHAG Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|