| 产品详情 |
| Edit |   |
| Antigenic Specificity | RHAMM/CD168 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RHAMM/CD168 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RHAMM/CD168. This antibody reacts with human. The RHAMM/CD168 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human RHAMM/CD168 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SSAAHTQATLLLQEKYDSMVQSLEDVTAQFESYKALTASEIEDLKLENSSLQEKVAKAGKNAEDVQHQILATESSNQEYVRMLLDLQTKSALKET |
| Other Names | CD168, CD168 antigen, hyaluronan mediated motility receptor, hyaluronan-mediated motility receptor (RHAMM), IHABP, Intracellular hyaluronic acid-binding protein, MGC119494, Receptor for hyaluronan-mediated motility, RHAMMMGC119495 |
| Gene, Accession # | HMMR, Gene ID: 3161, Accession: O75330, SwissProt: O75330 |
| Catalog # | NBP2-38459 |
| Price | |
| Order / More Info | RHAMM/CD168 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|