| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RFXANK |
|---|
| Clone | 4G10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RFXANK Antibody (4G10) from Novus Biologicals is a mouse monoclonal antibody to RFXANK. This antibody reacts with human. The RFXANK Antibody (4G10) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | RFXANK (NP_003712.1, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MELTQPAEDLIQTQQTPASELGDPEDPGEEAADGSDTVVLSLFPCTPEPVNPEPDASVSSPQAGSSLKHSTTLTNRQRGNEVSALPATLD |
|---|
| Other Names | ANKRA1Regulatory factor X subunit B, ankyrin repeat-containing regulatory factor X-associated protein, BLS, DNA-binding protein RFXANK, F14150_1, MGC138628, regulatory factor X-associated ankyrin-containing proteinAnkyrin repeat family A protein 1, RFXB, RFX-BRFX-Bdelta4 |
|---|
| Gene, Accession # | RFXANK, Gene ID: 8625, Accession: NP_003712, SwissProt: NP_003712 |
|---|
| Catalog # | H00008625-M01 |
|---|
| Price | |
|---|
| Order / More Info | RFXANK Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|