| Edit |   |
|---|
| Antigenic Specificity | RFXAP |
|---|
| Clone | 1B5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RFXAP Antibody (1B5) from Novus Biologicals is a mouse monoclonal antibody to RFXAP. This antibody reacts with human. The RFXAP Antibody (1B5) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | RFXAP (NP_000529 179 a.a. - 244 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDQALNCGGTASTGSAGNVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEV |
|---|
| Other Names | regulatory factor X-associated protein, RFX DNA-binding complex 36 kDa subunit, RFX-associated protein |
|---|
| Gene, Accession # | RFXAP, Gene ID: 5994, Accession: NP_000529, SwissProt: NP_000529 |
|---|
| Catalog # | H00005994-M01 |
|---|
| Price | |
|---|
| Order / More Info | RFXAP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|